PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001263.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 662aa    MW: 74627 Da    PI: 8.0922
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001263.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR156.11.2e-17184269291
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnH 87 
                               Yn+YA ++ Fsvr++k+++s +++++ +++f Csk+g++++  +       +++  rt C a ++  ++ +g+w vtk e+ HnH
  Itr_sc001263.1_g00004.1 184 IYNDYAFRLDFSVRRDKQRYSATTKTVEMKKFHCSKYGFKRDLGNG----CYSKVDVRTCCCAFVQFDLDGNGVWTVTKHEKLHNH 265
                              7****************************************98877....89999******************************* PP

                     FAR1  88 elap 91 
                              +l+p
  Itr_sc001263.1_g00004.1 266 DLVP 269
                              *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.6E-14184269IPR004330FAR1 DNA binding domain
PROSITE profilePS5141912.262339602No hitNo description
Gene3DG3DSA:3.40.50.3003.3E-27345517IPR027417P-loop containing nucleoside triphosphate hydrolase
SuperFamilySSF525408.77E-24349567IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM001751.4E-7350564No hitNo description
PRINTSPR004491.4E-10350371No hitNo description
PfamPF084779.8E-18351465IPR013684Mitochondrial Rho-like
PROSITE patternPS006750352365IPR025662Sigma-54 interaction domain, ATP-binding site 1
PRINTSPR004491.4E-10404426No hitNo description
PRINTSPR004491.4E-10478491No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007264Biological Processsmall GTPase mediated signal transduction
GO:0009640Biological Processphotomorphogenesis
GO:0032922Biological Processcircadian regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003924Molecular FunctionGTPase activity
GO:0005525Molecular FunctionGTP binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MGKENPSQRK TISVDLENQA IFTENDFSQI LAEVVFWTKA LASRPRLISF WLEFEVDVEV  60
PVGVAGSVTA TTTNRRSPSL FTTNRRPHHH KEVEIQLKID SVNGGLRKWK DWKQRRRAEE  120
MDTWDGKWVD SKHCDMEEVF AQQELVVTED DNAPVGLVNS KDLNPADQVL LGLSVSSIDE  180
AYEIYNDYAF RLDFSVRRDK QRYSATTKTV EMKKFHCSKY GFKRDLGNGC YSKVDVRTCC  240
CAFVQFDLDG NGVWTVTKHE KLHNHDLVPP SKSYLLRSHR TLSTNHLSYL KDLKKSGVYV  300
ADVQNLVLEK LSSLDAYYWV LRFLEQENMF WRERERESKE QNGGPPCGQV RVLLVGDSGV  360
GKTSLVHLIM KGSSIARPPQ TIGCSVSVKH ITFGNSGSSS SGTQNDSERD FFVELWDICG  420
HDRYKDCRSL FYSQINGVVF IYDLSQRRTK SSLSKWAAEI AATGTFSAPL ASGGPGGLPV  480
PYIVIGNKAD IASKEGTRGS SGNLVDVARQ WVEKQGFLPS SEELPLTESF PGNGGIFAAA  540
KEARYDKEAL QKFFRMLIRR RYYSDDLPGS PWTTSVHKPL QRSEISSDED NSYKSSSSSF  600
IADPYKYNAL PPLPAQRNLT PPPTLYPQQP MLTPDNYSIP RFALTSSQEI SSTRSKRTDI  660
NV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779354.10.0PREDICTED: uncharacterized GTP-binding protein At5g64813
SwissprotQ9C5J91e-179Y5483_ARATH; Uncharacterized GTP-binding protein At5g64813
TrEMBLA0A0V0I9E00.0A0A0V0I9E0_SOLCH; Uncharacterized protein
STRINGSolyc04g051700.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06250.17e-12FAR1-related sequence 7